SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL111W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL111W
Domain Number 1 Region: 151-241,316-404
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000143
Family WD40-repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGL111W
Sequence length 463
Comment NSA1 ORF Verified Constituent of 66S pre-ribosomal particles, involved in 60S ribosomal subunit biogenesis
Sequence
MRLLVSCVDSGSIKEVLCNIGTDTSVQSALQPFHVAPHLAEGLKAYVDRMWVISEDEAIL
ARNSGVVELVKISKHLKENEALQVDPKGESKNEKSLSDDLPKFDISEFEITSSVSDLFDD
AKLESLSSKSVKRTKLVDGFVTLCPIKKDSSNNTFVAATKSGLLHIIKKGEDKKLIKLAS
LGLKAPVEFLQLYDLEDTDTDKYIFAYGGEENLIKLVEIDSSFQSLKQIWEAKNVKNDRL
DMRVPVWPMALRFLEPSPGKTEKGKLNYQFAAITRWSHLTKYSTQHGRKPFAQIDLLPNR
EPLSQMEVFDAKGENVVSSLGNFQSETFNELNVITTDYKKNVFKFDGNGRMLGKVGRDDI
TGSSTYIHVHDGKYLLQGGLDRYVRIFDIKTNKMLVKVYVGSRINFIVMLDDVEIEMPLS
PSAKAAKEKQKRKVTELEEDADELWNKLEGKVAASKASKKSKI
Download sequence
Identical sequences A0A0L8VQL3 A0A250WCC4 C7GM05 E7QEN2 G2WDZ0
YGL111W YGL111W YGL111W YGL111W YGL111W YGL111W YGL111W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]