SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL213C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL213C
Domain Number 1 Region: 7-391
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.56e-43
Family WD40-repeat 0.000000000000622
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGL213C
Sequence length 397
Comment SKI8 ORF Verified Ski complex component and WD-repeat protein, mediates 3'-5' RNA degradation by the cytoplasmic exosome; also required for meiotic double-strand break recombination; null mutants have superkiller phenotype
Sequence
MSKVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFV
HKSGLHHVDVLQTIERDAFELCLVATTSFSGDLFFYRITREDETKKVIFEKLDLLDSDMK
KHSFWALKWGASNDRLLSHRLVATDVKGTTYIWKFHPFADESDSLTLNWSPTLELQGTVE
SPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVK
FSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVPTHSSQASLGEFAHSSWVMSLSFN
DSGETLCSAGWDGKLRFWDIKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDV
KFLKKGWRSGMGADLNESLCCVCLDRSIRWFREAGGK
Download sequence
Identical sequences A6ZTX6
YGL213C YGL213C YGL213C YGL213C tr|A6ZTX6|A6ZTX6_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]