SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL069C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL069C
Domain Number 1 Region: 247-592
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.8e-32
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL069C
Sequence length 594
Comment UTP18 ORF Verified Possible U3 snoRNP protein involved in maturation of pre-18S rRNA, based on computational analysis of large-scale protein-protein interaction data
Sequence
MTMATTAMNVSVPPPDEEEQLLAKFVFGDTTDLQENLAKFNADFIFNEQEMDVEDQEDEG
SESDNSEEDEAQNGDLDHVNNDQLFFVDDGGNEDSQDKNEDAMDVDDEDDSSSDDYSEDS
EEAAWIDSDDEKIKVPILVTNKTKKLRTSYNESKINGVHYINRLRSQFEKIYPRPKWVDD
ESDSELDDEEDDEEEGSNNVINGDINALTKILSTTYNYKDTLSNSKLLPPKKLDIVRLKD
ANASHPSHSAIQSLSFHPSKPLLLTGGYDKTLRIYHIDGKTNHLVTSLHLVGSPIQTCTF
YTSLSNQNQQNIFTAGRRRYMHSWDLSLENLTHSQTAKIEKFSRLYGHESTQRSFENFKV
AHLQNSQTNSVHGIVLLQGNNGWINILHSTSGLWLMGCKIEGVITDFCIDYQPISRGKFR
TILIAVNAYGEVWEFDLNKNGHVIRRWKDQGGVGITKIQVGGGTTTTCPALQISKIKQNR
WLAVGSESGFVNLYDRNNAMTSSTPTPVAALDQLTTTISNLQFSPDGQILCMASRAVKDA
LRLVHLPSCSVFSNWPTSGTPLGKVTSVAFSPSGGLLAVGNEQGKVRLWKLNHY
Download sequence
Identical sequences A0A250WHL3
YJL069C YJL069C YJL069C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]