SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR033C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR033C
Domain Number 1 Region: 97-308,379-468
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-19
Family WD40-repeat 0.018
Further Details:      
 
Domain Number 2 Region: 377-540,586-716
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000114
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJR033C
Sequence length 1357
Comment RAV1 ORF Verified Subunit of the RAVE complex (Rav1p, Rav2p, Skp1p), which promotes assembly of the V-ATPase holoenzyme; required for transport between the early and late endosome/PVC and for localization of TGN membrane proteins; potential Cdc28p substrate
Sequence
MSLNFLPGRPNATPQTACQATWQNHTIFAYCSGNNLIILTNKFTRLQTIYTQSDCTAVDI
NSQNGFIALSFHNRVLIYKPIHQIMQNPKWTQCCQLFHDDTPVNCLRWSSDNELAIGSDF
LSFWKIKDNFGVYQPILQWNQKQPKPVYNVIISQDSQLIVSIGKYDCNAKLWKRVSIVGE
QAIFNLTMLPHPKPITAMRWKKEPDQVSKNNTASHALYTLCEDKVLRIWSCFEMEKNHTV
QIWGEVPLSPTQKFCVIIDNWIIRQTLSVKDSEVFDISDSDIVILGSMTGEMEVLALNNL
SQDPPKPMTKKTISHKKVKKATMLNDTRYLYFPEIQPYDNVKGKLSFLVHDLQGVIRHLL
IDILQLINNKTEDLSAALEHKFTGHNKSVQKLVRSSDGEALLTTSRFSENGVWYPQKLNH
GVSLRLQNTIQTESPIKFAVVHELGKLVICLLENGALQAWECPTNRKEDSEQKQSYLRVE
TRLKEDKKIRPIVMLNTPEPKHSHERHFTALIFSDGSIKAFEVSLTRGIFEVKSDSLDID
GDDIYKISIIDPVHQTFVSNRPLISLITKKGLTRTYKAIVNYNDRHVQWIKACEINTGIM
NCTCIRGSSTGKLCIVNSTGKVMSLWDLNRGVLEYEETFHNPIEDIDWTSTEYGQSIVSI
GFTGYALLYTQLRYDYTNNTPSYLPIEKIDITAHTAHNIGDSVWMKNGTFVVASGNQFYI
KDKSLDLTDPFTYQSIGSRKILSNDILHLSSVLNGPLPVYHPQFLIQAIYANKLQLVKEL
LLRLFLALRKLDFESQDVSNLDSNLGMDPLKYFIAKDRDYPVESFPDPYPCFNKTVSLAL
TEQLTKTTLPYLTRHQQITLITVIEAVDEVTKNENIVDYNGVRFLLGVKLFLSHKNIQKS
ILMRDVSWALHSDNKEILLSSIDRHITSWNRAREYRIAYWIKEQDLVKKFEDIAKYEFSK
DDKRDPSRCAIFYLALKKKQILLSLWKMAIGHPEQQKMVRFISNDFTVPRWRTAALKNAF
VLLSKHRYMDAAVFFLLTDSLKDCVNVLCKQVHDMDLAIGVCRVYEGDNGPVLGELLTAQ
MLPETIKENDRWKASFIYWKLRKQEVAIKALLTAPIDLENNSSIVDKEVCVNRSFLVEDP
ALLYLYNHLRNRNLKYFIGSLNVEAKIECTLILRVTDILCRMGCNYLAVSLVKNWKFIER
NSIPVQKLLKSPTKDRAYSAIGAMASEPISTARMRPSLFDKFGSPSASDIESPNPKLPNS
LLDDFLQPPPNSTSSNSLAQSSSSAPRSILDEFVSPSYSQHKENLTPKAPNDSVGETDNS
ENRKDKLSKDILDDLSSQKPQKPKKSAITKNLLDDFV
Download sequence
Identical sequences YJR033C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]