SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJR039W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJR039W
Domain Number - Region: 547-781
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00116
Family WD40-repeat 0.032
Further Details:      
 
Domain Number - Region: 866-909
Classification Level Classification E-value
Superfamily GFP-like 0.0994
Family Domain G2 of nidogen-1 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJR039W
Sequence length 1121
Comment ORF Uncharacterized Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MLAGRIRIAMTDNIIVSEVDGPPDVVKCFIREEDGLEGQSRELVVIGLEYIDVFEGVEQD
EARKKLRLRTVGYTVAAFYFKDHTAPNRRFYILLKATGRLDFVNLDYKIVKSLETGIDQV
RSEPKFMFQDPLRTALVFNLSCTEIYEISTEDIFCLEETDVKLSYVTSSPIVSIDACINF
NDFLDKDVFTLSILTRAHNEVAYKLEACVCVFESKPAKGTKWQRTTNLTFVEEATVSQVL
LKSVTNIGHFVFTPWKTYFIKHALSSKQTIDGKTVDKIYQGPGAFGSDNMERIELLQPIL
ADTTLNHLTFTFMTSTAILITCRMNAILSSFEDDTYIWEKALFERLPINGGSSHDHYLAA
FFNEKCWILVSPKGHLTVYSVRNEGHSNFVHLGSFLCKSTLYSDLIGNYTKSHLSCGSLH
CGQGYLCLKFRSCGDIFASTCMKLLFKSKDSVPRQVYSTRKGIYWADVNNNVYRDSERID
FEINGSFIATKDGTLLKDNTIVTLVPIQRDNECNYAYVTKQGYLRWSFSKVYYRIQNTGV
DLTIDNCFLSAISSKGSFLTVLVLNDEITVFDHCNRLKSQKVVFHRLSDLASIFLYEYES
TVYIFMSDTEGNLCVMKLATFEIVEEVKICKKKLQFCEVPNSDYFFIYTADTIIFFKPSK
IKGRFKIQEVYAPCPISCLIPGEKDGSVVMVTSQGQFYDVLVPGDAGRATLCSKFEKVLK
TCLKFITLESSSRYVIVAALPVANPLQDKYSEIYVYDIKQFKNISAFNFSNLNNDIESIK
YENAMISDIIAVPMLKRTETLGKRKTSELYKEVIFNSCILVSLNLDSIDDIDSKNMNNLL
LFSFDEESGFIEFVFGINTGFSISGLHNYYNGCVLVYGEFVQAYQLNYSVHDNKFSIEQV
SNRLNISGITITSSIFFDKRKAKMARKQQNIGTWVYLEEMILLDVRKGVMRFNVIHTTDG
NIEKVQLQVQPLNLFERDLINSITGTGKMFTGAAAITFKNIRYLLISYGDQKLTLFSLKL
DGEEEIDERVYHVAEQVTTINSVRTTDSRMSTFLGESTFMPLFLVSTLSNGCYVIGILHE
ESDISLHILSEKKAVFAKRSVQKFLGFLDPQMDDHTVISEI
Download sequence
Identical sequences YJR039W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]