SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKL018W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL018W
Domain Number 1 Region: 28-328
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.56e-41
Family WD40-repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKL018W
Sequence length 329
Comment SWD2 ORF Verified Subunit of the COMPASS (Set1C) complex, which methylates histone H3 on lys 4 and is involved in telomeric silencing; subunit of CPF (cleavage and polyadenylation factor), a complex involved in RNAP II transcription termination
Sequence
MTTVSINKPNLLKFKHVKSFQPQEKDCGPVTSLNFDDNGQFLLTSSSNDTMQLYSATNCK
FLDTIASKKYGCHSAIFTHAQNECIYSSTMKNFDIKYLNLETNQYLRYFSGHGALVNDLK
MNPVNDTFLSSSYDESVRLWDLKISKPQVIIPSLVPNCIAYDPSGLVFALGNPENFEIGL
YNLKKIQEGPFLIIKINDTTFSQWNKLEFSNNGKYLLVGSSIGKHLIFDAFTGQQLFELI
GTRAFPMREFLDSGSACFTPDGEFVLGTDYDGRIAIWNHSDSISNKVLRPQGFIPCVSHE
TCPRSIAFNPKYSMFVTADETVDFYVYDE
Download sequence
Identical sequences A0A0L8VLX7 A6ZZU7 B3LR67 B5VMD7 C8ZCF0 E7KQR0 H0GJB0
YKL018W YKL018W tr|A6ZZU7|A6ZZU7_YEAS7 YKL018W SCRT_04002 YKL018W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]