SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR208W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR208W
Domain Number 1 Region: 12-288
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.15e-51
Family SCOPe 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR208W
Sequence length 297
Comment SEC13 ORF Verified Component of both the Nup84 nuclear pore sub-complex and the Sec13p-Sec31p complex of the COPII vesicle coat, required for vesicle formation in ER to Golgi transport and nuclear pore complex organization
Sequence
MVVIANAHNELIHDAVLDYYGKRLATCSSDKTIKIFEVEGETHKLIDTLTGHEGPVWRVD
WAHPKFGTILASCSYDGKVLIWKEENGRWSQIAVHAVHSASVNSVQWAPHEYGPLLLVAS
SDGKVSVVEFKENGTTSPIIIDAHAIGVNSASWAPATIEEDGEHNGTKESRKFVTGGADN
LVKIWKYNSDAQTYVLESTLEGHSDWVRDVAWSPTVLLRSYLASVSQDRTCIIWTQDNEQ
GPWKKTLLKEEKFPDVLWRASWSLSGNVLALSGGDNKVTLWKENLEGKWEPAGEVHQ
Download sequence
Identical sequences A0A0L8VL68 A0A250WKD8 A7A196 B3RH97 B5VNC6 C7GIT7 C8ZDH2 E7KFP1 E7KRU1 E7LXQ0 E7NKR3 G2WJ38 N1NZT9 Q04491
YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W YLR208W 2pm6_B 2pm6_D 3iko_A 3iko_D 3iko_G 3mzk_A 3mzk_D 3mzl_A 3mzl_C 3mzl_E 3mzl_G 4bzk_B 4xmm_A 4xmn_A YLR208W YLR208W YLR208W YLR208W NP_013309.1.97178 YLR208W YLR208W SCRT_04166 000397914|e3mzkA1|5.1.4.201|A:1-297 000397915|e3mzkD1|5.1.4.201|D:1-297 YLR208W YLR208W YLR208W YLR208W YLR208W 4932.YLR208W YLR208W tr|A7A196|A7A196_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]