SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR222C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR222C
Domain Number 1 Region: 383-648
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-60
Family WD40-repeat 0.00016
Further Details:      
 
Domain Number 2 Region: 58-278,382-466
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.32e-43
Family WD40-repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  YLR222C
Domain Number - Region: 243-367
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0549
Family WD40-repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR222C
Sequence length 817
Comment UTP13 ORF Verified Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA
Sequence
MDLKTSYKGISLNPIYAGSSAVATVSENGKILATPVLDEINVIDLTPGSRKILHKISNED
EQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVG
GTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKR
KCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFNMKKKCKLLKTLPVN
QQVESCGFLKDGDGKRIIYTAGGDAIFQLIDSESGSVLKRTNKPIEELFIIGVLPILSNS
QMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGNHGIIADMRYVGPELNKLALATNSP
SLRIIPVPDLSGPEASLPLDVEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNEN
SCKFDIYAKYIGHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQII
KVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVS
FCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIK
IWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKDCTEQEIEEEQEKAK
LQVEQEQSLQNYMSQGDWTNAFLLAMTLDHPMRLFNVLKRALGESRSRQDTEEGKIEVIF
NEELDQAISILNDEQLILLMKRCRDWNTNAKTHTIAQRTIRCILMHHNIAKLSEIPGMVK
IVDAIIPYTQRHFTRVDNLVEQSYILDYALVEMDKLF
Download sequence
Identical sequences YLR222C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]