SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR233C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR233C
Domain Number 1 Region: 60-584
Classification Level Classification E-value
Superfamily TPR-like 3.49e-54
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR233C
Sequence length 699
Comment EST1 ORF Verified TLC1 RNA-associated factor involved in telomere length regulation as recruitment subunit of telomerase; has G-quadruplex promoting activity that is required for telomere elongation; possible role in activating telomere-bound Est2p-TLC1-RNA
Sequence
MDNEEVNEECMRLFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHCKSTRFLEELLL
KQENMYHNNNYERINDSVIPLVLKLLWLQIHEPTLQWFEHWFHDIMRLSNRRKFRVFRIF
QKKMIQFFKITHRYYYDIIEHLCAKYDMNSVISNALFAKLNLMQYTDGLSTHEKIILNTS
NPLTFSIVISLQRCVINLGSTHFYKTLLNKPSNKPKSVEGFEKSIRYLNIASLYLPAVGD
TYFQRAKIYLITGKFSLYFFELVRGALVRIPSKCALNNLKDFILTPNFPERRRLMKKLAI
LVSKDLKGEKSFFEGQIVLQFLSIVEHTLVPQSWNASRASNCWLLKEHLQIAALKYHSGN
INVILENLAATMGSFDLMFTTRKSKEQKNKLKYADLSERQVFFLDLSFDFIANIIDVVIK
PSWQKNMEDFRYLAIIRLLMCWIKSYRSILQYTHRHRKFCTSFALLLNDLINSPLNCSGN
IYSHRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKMLSPKE
ECVLRIRSIIFSGMKFLEKNDTGVIWNASKHKFDLISPDIKMKRQIALSEISSKINVKTQ
QERVVTSRKVEAKRDEQQRKRAGEIAVTELEKQFANVRRTKKLSPLPEKDGVSSELVKHA
ASRGKKTITGPLSSDFLSYPDEAIDADEDVTVQVPDTPT
Download sequence
Identical sequences YLR233C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]