SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR093W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR093W
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.99e-43
Family SCOPe 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR093W
Sequence length 513
Comment UTP15 ORF Verified Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA
Sequence
MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSS
TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSI
NASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAA
PHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLT
SNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSG
PVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRM
MRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQE
LRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVL
QELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS
Download sequence
Identical sequences A0A0L8VJR9 A6ZMF0 B3LLY4 E7KGN2 E7NLJ1 N1NYC0 Q04305
tr|A6ZMF0|A6ZMF0_YEAS7 NP_013811.1.97178 YMR093W YMR093W YMR093W YMR093W YMR093W YR300 YMR093W SCRT_01983 4932.YMR093W YMR093W YMR093W YMR093W YMR093W YMR093W YMR093W YMR093W 5wlc_LJ

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]