SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR102C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR102C
Domain Number 1 Region: 172-204,268-506,572-593
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.66e-44
Family WD40-repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  YMR102C
Domain Number - Region: 793-831
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0068
Family Transcriptional factor domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR102C
Sequence length 834
Comment ORF Uncharacterized Protein of unknown function; transcription is activated by paralogous transcription factors Yrm1p and Yrr1p along with genes involved in multidrug resistance; mutant shows increased resistance to azoles; YMR102C is not an essential gene
Sequence
MTNMAEDKTSISKVHSEFSNSSNTTGSEEESRSHQESFDGESSSGESKSKSKLNLEYSAD
IEPLKFRMTKTNNTNDKLKYSNNGNATDSFMRLKEHLQRGNTLNSNLRVNEFYPFNSIDT
EQFENYLREPKYIKMLKRRKNLKQFRRLFLAQELMAYEGETVTSTSKSSEPTSKAIWSTK
FSRDGKFMATGSKDGKIRIWKVIGSPVERAELDSSAESNKEARAKSMRIKQQVSSLNNPK
EKQFLDSATEKYEEKEKLLNLYAPVFHPTPLRLYKEHVQDVLDINWSKNNFILSASMDKT
VKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRFFISGCLDHKCRLWSILDDEVSFEYDCQ
DLITSVTLSPEEGKYTIIGTFNGYVHILMTRGLTPVSSFHVADRQTQEQNAHVMVTETDS
KIRHGPRVTGLQAFRSQLDNSFRLVVTSNDSRIRIFDLEQRKLLEVLKGFHSGSSQHKAQ
LSIWHGQPIVVNSSDDHWVYGWRLKSSDRENDQDEPKRKPKGLARSGSLRSIFSKSMSRS
SSQNNEEKPHHHLKLTNLLPLPHHSNDHYIKNTDYISFHAHNAPVTCVSIAPPETSKTLS
LSNDVICELSLEFFQTSDSFDVLSRSNDDGIMSDVESSLGYNSKPGSISNASATSAIPDV
VDAIGTILISTDNVGTIRVFRADMPSVIRKRVLLKLEEYNREVRRRFNSSDSLHSLSRSF
NSRAKSNLAGQPAAAYTNTGKGYATGRGYSNICPKSSTSLKTLGSNAQPRTPRESMSSIF
SNAHGPTTPTSAMNLPIRCNVCNGSRFEAFSGANDQQDRNYYCVDCGTVVNNFR
Download sequence
Identical sequences A0A0L8VKM9 A6ZMF9 B3LLZ3 G2WKF0 Q03177
YMR102C NP_013820.1.97178 YMR102C YMR102C YMR102C YMR102C YMR102C YMR102C YMR102C 4932.YMR102C tr|A6ZMF9|A6ZMF9_YEAS7 SCRT_01992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]