SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR146C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR146C
Domain Number 1 Region: 12-328
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.23e-50
Family SCOPe 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR146C
Sequence length 347
Comment TIF34 ORF Verified eIF3i subunit of the core complex of translation initiation factor 3 (eIF3), which is essential for translation; stimulates rate of ribosomal scanning during translation reinitiation
Sequence
MKAIKLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDV
DCFTKYCVTGSADYSIKLWDVSNGQCVATWKSPVPVKRVEFSPCGNYFLAILDNVMKNPG
SINIYEIERDSATHELTKVSEEPIHKIITHEGLDAATVAGWSTKGKYIIAGHKDGKISKY
DVSNNYEYVDSIDLHEKSISDMQFSPDLTYFITSSRDTNSFLVDVSTLQVLKKYETDCPL
NTAVITPLKEFIILGGGQEAKDVTTTSANEGKFEARFYHKIFEEEIGRVQGHFGPLNTVA
ISPQGTSYASGGEDGFIRLHHFEKSYFDFKYDVEKAAEAKEHMQEAN
Download sequence
Identical sequences A0A0L8VJK5 A0A250WEB8 A6ZMK5 B3LM34 B5VPS2 C7GQ86 C8ZF03 E7KGS8 E7LYS0 E7Q7V5 E7QJC8 G2WKJ7 H0GL61 N1NYG2 P40217
YMR146C SCRT_02037 YMR146C YMR146C YMR146C YMR146C YMR146C YMR146C YMR146C YMR146C YMR146C cath|current|4u1eI00/1-342 YMR146C 3jap_q 3jaq_q 4u1e_I 5a5u_I YR274 YMR146C YMR146C YMR146C YMR146C sp|A6ZMK5|EIF3I_YEAS7 YMR146C YMR146C YMR146C YMR146C 4932.YMR146C YMR146C NP_013866.1.97178 YMR146C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]