SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL187W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL187W
Domain Number 1 Region: 7-249
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000000916
Family WD40-repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL187W
Sequence length 357
Comment SWT21 ORF Uncharacterized Protein involved in mRNA splicing; contains a consensus nuclear export signal (NES) sequence similar to the consensus sequence recognized by Crm1p; interacts genetically with Prp40p and Tgs1p; contains WD40 repeats
Sequence
MEKKVICQDIFWSCDGTSFVSVHNDFGIRQYLVPEEGNTDKLNRNLLLPFTRFFRNQSIV
SCAIDPFYSLYNENSDRLAGDRIVVGGKNFPLQLYSLMDGQCILSYDTMNKINGEYETVY
SVKIDVESRVYTGSCRNKVAIYDKSRRDAVWVNQSTKKASKGRQSIISCFEEQPMGGQAL
SRGSLLCGSYANEMFQVDCRHQRLERLNYTRTVAGGIVQILTSDNGRYVYVVRRNSDAIS
IYDRRNLQHELNVLRLPFRIHHNSAKLKAYIDTAYGLSMGTPQGTILNWGRDLVEFGGVP
SHNSVEDPLITSIPPESEWRTNLDSTIPATVVKNCPGDPELFALSHGGTISLCRFGG
Download sequence
Identical sequences G2WLS3
YNL187W YNL187W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]