SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL253W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL253W
Domain Number 1 Region: 60-358
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.35e-34
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL253W
Sequence length 422
Comment TEX1 ORF Verified Protein involved in mRNA export, component of the transcription export (TREX) complex
Sequence
MSTIGAVDILNQKTITSEVAASVTSKYLQSTFSKGNTSHIEDKRFIHVSSRSHSRFTSTP
ITPNEILSLKFHVSGSSMAYSRMDGSLTVWFIKDASFDKSVEVYIPDCCGSDKLATDLSW
NPTSLNQIAVVSNSSEISLLLINEKSLTASKLRTLSLGSKTKVNTCLYDPLGNWLLAATK
SEKIYLFDVKKDHSSVCSLNISDISQEDNDVVYSLAWSNGGSHIFIGFKSGYLAILKAKH
GILEVCTKIKAHTGPITGIKMDPWGRNFITGSIDGNCYVWNMKSLCCELIINDLNSAVTT
LDVCHLGKILGICTEDEMVYFYDLNSGNLLHSKSLANYKTDPVLKFYPDKSWYIMSGKND
TLSNHFVKNEKNLITYWKDMFDNTMIEKRRKNNGGGNNHNKRTSKNTDRIGKDRPSRFNS
KK
Download sequence
Identical sequences A6ZRJ0
YNL253W YNL253W tr|A6ZRJ0|A6ZRJ0_YEAS7 YNL253W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]