SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL317W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL317W
Domain Number 1 Region: 74-377
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-65
Family WD40-repeat 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL317W
Sequence length 465
Comment PFS2 ORF Verified Integral subunit of the pre-mRNA cleavage and polyadenylation factor (CPF) complex; plays an essential role in mRNA 3'-end formation by bridging different processing factors and thereby promoting the assembly of the processing complex
Sequence
MDGHNQNQYQNQNQIQQSQQPPLKKYVTQRRSVDVSSPYINLYYNRRHGLPNLVVEPETS
YTIDIMPPNAYRGRDRVINLPSKFTHLSSNKVKHVIPAIQWTPEGRRLVVATYSGEFSLW
NASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESI
RDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKD
NLVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMC
VRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTIPYAHDKCITSLSYNP
VGHIFATAAKDRTIRFWTRARPIDPNAYDDPTYNNKKINGWFFGINNDINAVREKSEFGA
APPPPATLEPHALPNMNGFINKKPRQEIPGIDSNIKSSTLPGLSI
Download sequence
Identical sequences A0A0L8VIX5 A0A250WGD0 A6ZSG3 B5VQA3 C8ZGK8 G2WLF2 N1NZ89 P42841
YNL317W YNL317W NP_014082.1.97178 YNL317W YNL317W tr|A6ZSG3|A6ZSG3_YEAS7 YR278 YNL317W YNL317W YNL317W YNL317W YNL317W YNL317W YNL317W 4932.YNL317W YNL317W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]