SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL063C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOL063C
Domain Number - Region: 243-367
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000476
Family WD40-repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOL063C
Sequence length 956
Comment CRT10 ORF Verified Protein involved in transcriptional regulation of RNR2 and RNR3; expression of the gene is induced by DNA damage and null mutations confer increased resistance to hydroxyurea; N-terminal region has a leucine repeat and a WD40 repeat
Sequence
MPPQIPNENDDLFTRWLKSRAIIQRAVSTRECFDSEVFLASGGWNITNEMVTLKKYYQLK
WPNSSCNSFHPKTVEFIKERLHNLEEHDSSWKIPNPAYSSKKAFLEDTKSAFSNLEPVWG
PSRLLNPAELLLPQDEKLLVQEIPLEFAPFQYTNRFAYGGLQFKNNLFVTYGSYSFLAAG
QCVEVHNFDVLLNVSSLEICHALLPVIIPDDGDVRNFRNSSYVKFKDTQFNSIPELCSIN
FMKICNFMHQDFLLACGDNGIVYIWEINKVIKIFNKFTSDILGGKDNSRERYINVDPYMV
LRVEESCWSVDVIDINGIIYIAVGHNKPGVTVFAFDKDVKKERRYIRPLDLPSSHNVPCV
NFVPNSKDSAGYITLSYCSIFGNVVTVKLKEHDCTILTSFLDTQFFGDDLWTITPLTKKD
FAKVDNFESLNLNYQDGFKESMLYSICRDDFLLGYYCDNAYLSGNFGIGTLLNQFQVPVT
DLRLTSSAGIPDEVIPLRFTSFDRNYTTTGSIKYEYSREDFALILHAGDLDDMNDAVTKN
TSCEQHLHQWTFWEDSGYKHYRATERGFSKYKDIINTFPQLITPSGRNKTSQYQNTSGRK
ICEPFTYKLTDLENDIEDISREFNRSIRNLKMDKQRQLRTSKEFKSLSSVNHLPNIESGN
FLWYNTDAAADWRTLFGKDLNTVLKDPEICSLQLNSTEEDDVNSDPENEESGSSLTSFQR
RYRDTEQRAHLKSESQKSWGFHNYVRNVKRLLESVVPGSEDSPLGYQLSEMHDEFFFLTT
AHRLVLMKANPLIIISATHHEIFPLDGVVTCASKSLLQALNRINFVCHIKELNCIAVASQ
LGLISLLRLTEYRGIYSFRQEYILGWEVQDPVNPSPECRCNRNLFDAPMYGADGESSDTY
CGVCDVYFPMGDICGLDYTYASDSEELKRKGYATLYVASRGSLRAFKITTEHETTQ
Download sequence
Identical sequences A0A0L8VI20 A6ZNE7 C7GK30 E7KI28
tr|A6ZNE7|A6ZNE7_YEAS7 YOL063C YOL063C YOL063C YOL063C YOL063C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]