SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR038C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR038C
Domain Number 1 Region: 21-210,250-355
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.76e-18
Family Cell cycle arrest protein BUB3 0.05
Further Details:      
 
Domain Number 2 Region: 291-356,499-690
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000549
Family DPP6 N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOR038C
Sequence length 875
Comment HIR2 ORF Verified Subunit of the HIR complex, a nucleosome assembly complex involved in regulation of histone gene transcription; recruits Swi-Snf complexes to histone gene promoters; promotes heterochromatic gene silencing with Asf1p
Sequence
MRLLKYPLDIHNEQVNALAALGPYIILAGSGGHVMAWRQQQLVDTAFDRVMIKDLKPEVS
FQVDQDTTGDIFFITGDLETLYIGSEHRLWGYSGWLCRDTNNINSVEKMNSKLLFECKSP
STITDVKYDINLGILFVLLSNENKILLFRHKTFDKLSEITIDKASKPITGIIDPTGQTFT
VMTSDRSILVYQINKTGTHKLINKLTQHVQMYPLHYRISMSPQADILPVINSVKGVPNNA
TSCTALLDRNNNYKVTKTLVTPSSNGCRVLVYSPAFYEKPNLKKGTSTRYNLIATSGSTD
GTILVWNTKRMKPLFNALQVSSTAINDMSWSQDGFTLFAISNDATLYTFAFQEKDLGVAL
PQTEIKSLQEVNKKLPKLEEPLAEQIPKSFPENIKLEESASAAPIPNDIGRSAVGKKTTK
KKTANNQTNGIKTIQSTSMEFNTPSYTVPRDLKRKPKEATPSNIAPGSKKQKKELQPIDF
LDTGLLLPNTSFSRIRLATPKIRSTFKYSPINNPNLILDVKNGSGNEQRPTIVKLTSKVL
DQDQVLFQDFIPKLITICTAGDTFWSFCSEDGSIYIYSDSGRKLMAPLVLGVSISFLEAC
GTYLLCLTSIGELYCWNIEQKKLAFPTNTIYPLLNPSLRYSDDILTRAENITLCSITKKG
VPLVTLSNGDGYLFDKNMEAWLLVSDGWWAYGSQYWDTTNTTGLSSSKANTDSFNGSESN
INEIVSDIKNDNQSIINFLERKTNDELNRKGRIKNLQRFARTILMKEGFENMEEIVTLSH
LENKILISIRLEEPEEFSKLMMVYCIRLSELGYMDRLNDVFQWLYDDLPISGTGSAFADK
DFKRNLLKKILIACGDIRQVQRVTTRYAKEMNIIS
Download sequence
Identical sequences A0A250WB36 N1NWU9
YOR038C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]