SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR229W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR229W
Domain Number 1 Region: 193-449
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.04e-20
Family WD40-repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR229W
Sequence length 464
Comment WTM2 ORF Verified Transcriptional modulator involved in regulation of meiosis, silencing, and expression of RNR genes; involved in response to replication stress; contains WD repeats
Sequence
MAKSKSNQGASGARRKPAPSLYQHISSFKPQFSTRVDDVLHFSKTLTWRSEIIPDKSKGT
LTTSLLYSQGSDIYEIDTTLPLKTFYDDDDDNDDDEKGNGKTKSAATPNPEYGDAFQDVE
GKPLRPKWIYQGETVAKMQYLESSDDSTAIAMSKNGSLAWFRDEIKVPVHIVQEMMGPAT
RYSSIHSLTRPGSLAVSDFDVSTNMDTVVKSQSNGYEEDSILKIIDNSDRPGDILRTVHV
PGTNVAHSVRFFNNHLFASCSDDNILRFWDTRTADKPLWTLSEPKNGRLTSFDSSQVTEN
LFVTGFSTGVIKLWDARAVQLATTDLTHRQNGEEPIQNEIAKLFHSGGDSVVDILFSQTS
ATEFVTVGGTGNVYHWDMEYSFSRNDDDNEDEVRVAAPEELQGQCLKFFHTGGTRRSSNQ
FGKRNTVALHPVINDFVGTVDSDSLVTAYKPFLASDFIGRGYDD
Download sequence
Identical sequences YOR229W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]