SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR230W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR230W
Domain Number 1 Region: 181-433
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.21e-22
Family WD40-repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOR230W
Sequence length 437
Comment WTM1 ORF Verified Transcriptional modulator involved in regulation of meiosis, silencing, and expression of RNR genes; required for nuclear localization of the ribonucleotide reductase small subunit Rnr2p and Rnr4p; contains WD repeats
Sequence
MPKKVWKSSTPSTYEHISSLRPKFVSRVDNVLHQRKSLTFSNVVVPDKKNNTLTSSVIYS
QGSDIYEIDFAVPLQEAASEPVKDYGDAFEGIENTSLSPKFVYQGETVSKMAYLDKTGET
TLLSMSKNGSLAWFKEGIKVPIHIVQELMGPATSYASIHSLTRPGDLPEKDFSLAISDFG
ISNDTETIVKSQSNGDEEDSILKIIDNAGKPGEILRTVHVPGTTVTHTVRFFDNHIFASC
SDDNILRFWDTRTSDKPIWVLGEPKNGKLTSFDCSQVSNNLFVTGFSTGIIKLWDARAAE
AATTDLTYRQNGEDPIQNEIANFYHAGGDSVVDVQFSATSSSEFFTVGGTGNIYHWNTDY
SLSKYNPDDAIAPPQDATEESQTKSLRFLHKGGSRRSPKQIGRRNTAAWHPVIENLVGTV
DDDSLVSIYKPYTEESE
Download sequence
Identical sequences YOR230W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]