SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL007C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL007C
Domain Number 1 Region: 88-210,313-350
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000168
Family WD40-repeat 0.043
Further Details:      
 
Weak hits

Sequence:  YPL007C
Domain Number - Region: 189-260
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00879
Family Pectate lyase-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL007C
Sequence length 588
Comment TFC8 ORF Verified One of six subunits of RNA polymerase III transcription initiation factor complex (TFIIIC); part of TFIIIC TauB domain that binds BoxB promoter sites of tRNA and other genes; linker between TauB and TauA domains; human homolog is TFIIIC-90
Sequence
MKLLKDLLVDRKEFEDWKNNLTWARDGTLYLTTFPDISIGQPKYAKDINCNSKNLFHVKE
FPLEFENKLDFELAQQNGLLNSQPVCYPRVCKPSPIDDWMAVLSNNGNVSVFKDNKMLTN
LDSKGNLSSRTYHCFEWNPIKSSIVVGNEDGELQFFSIRKNSENTPEFYFESSIRLSDAG
SKDWVTHIVWYEDVLVAALSNNSVFSMTLSASSHQPVSRMIQNASRRKITDLKIVDYKVV
LTCPGYVHKIDLKNYSISSLKTGSLENFHIIPLNHEKESTILLMSNKTSYKVLLEDELHV
TADNIIAPYLEKKFKKWSTIWNEFNNYETTLVIHGISLSPDGYSIAIVYDMERVAFKYKI
ASEQSFNIMFAPLYHTWTISERAVGLAWYQTYQIYNQSLPKLPENFSMNKKLLNGNYPIS
LDFQSYLNALMKSEEMRIIMFLNMTIDKPSILSFLEALYEYAINKKSELTNSFDLACVLS
IAAILKREAPIYNGTLLMKNSFLEETFNLESFTADPETVASTTNNTWKRCGVTLLPILTT
HVKICPVSKQRVIDIKRDDLNDYGWFTRGLLERFNEISVYCGTTLEVM
Download sequence
Identical sequences YPL007C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]