SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL139C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL139C
Domain Number 1 Region: 182-449
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.04e-22
Family WD40-repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL139C
Sequence length 460
Comment UME1 ORF Verified Negative regulator of meiosis, required for repression of a subset of meiotic genes during vegetative growth, binding of histone deacetylase Rpd3p required for activity, contains a NEE box and a WD repeat motif; homologous with Wtm1p, Wtm2p
Sequence
MSTLDIAEDNKIKNEEFKIWKKSIPSLYQHISSLKPIFGSGVDESPSTLRSIVFTNDSSC
NKSKGVLSVPLLYSQGSEIFEVDCIVPLGLHYKKPESISEPLVQPDYTMESQKVEQTVLI
PKWEFKGETIAKMIYVDNSEINVKVIALSTNGSLAWFREGVKSPVYTMMEPSTSLSSASS
GNQNKPCVDFAISNDSKTLAVTKEKHLDNENATIKLIDNSGKIGEVLRTIPVPGIKNIQE
IKFLNNQIFATCSDDGIIRFWGNEIGKKPLWILNDSLDGKTTCFAASPFVDTLFMTGTSG
GALKVWDIRAVIALGDADAELNINQGHNKVNELFKVHHFYSEQVSKIEFSSISPMEVVTI
GGLGNVYHWNFEPVFAIYNEINEDFQGIISDELEAESMAFYHTEGCRREIGENIKVNTVA
YHKYIEDLVATVDSDGLLTVYKPFTGKVLDGSREVGAAKS
Download sequence
Identical sequences YPL139C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]