SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL151C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL151C
Domain Number 1 Region: 124-427
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.45e-71
Family WD40-repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPL151C
Sequence length 451
Comment PRP46 ORF Verified Member of the NineTeen Complex (NTC) that contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs
Sequence
MDGNDHKVENLGDVDKFYSRIRWNNQFSYMATLPPHLQSEMEGQKSLLMRYDTYRKESSS
FSGEGKKVTLQHVPTDFSETSQAVISKKDHDTHASAFVNKIFQPEVAEELIVNRYEKLLS
QRPEWHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAG
HVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIA
TAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKT
MKVLTHHKRSVRATALHPKEFSVASACTDDIRSWGLAEGSLLTNFESEKTGIINTLSINQ
DDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEAD
KSIKIWKQDETATKESEPGLAWNPNLSAKRF
Download sequence
Identical sequences A0A250WDS5 G2WP32
YPL151C YPL151C YPL151C YPL151C 5lj3_J 6exn_J

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]