SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR032W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR032W
Domain Number 1 Region: 74-311
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.48e-19
Family WD40-repeat 0.041
Further Details:      
 
Weak hits

Sequence:  YPR032W
Domain Number - Region: 507-581,628-842
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000387
Family WD40-repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPR032W
Sequence length 1033
Comment SRO7 ORF Verified Effector of Rab GTPase Sec4p, forms a complex with Sec4p and t-SNARE Sec9p; involved in exocytosis and docking and fusion of post-Golgi vesicles with plasma membrane; homolog of Sro77p and Drosophila lgl tumor suppressor
Sequence
MFGSKRLKNVKEAFKSLKGQNSETPIENSKASFKSKNSKTSTISKDAKSSSSLKIPISSN
NKNKIFSLAETNKYGMSSKPIAAAFDFTQNLLAIATVTGEVHIYGQQQVDVVIKLEDRSA
IKEMRFVKGIYLVVINAKDTVYVLSLYSQKVLTTVFVPGKITSIDTDASLDWMLIGLQNG
SMIVYDIDRDQLSSFKLDNLQKSSFFPAARLSPIVSIQWNPRDIGTVLISYEYVTLTYSL
VENEIKQSFIYELPPFAPGGDFSEKTNEKRTPKVIQSLYHPNSLHIITIHEDNSLVFWDA
NSGHMIMARTVFETEINVPQPDYIRDSSTNAAKISKVYWMCENNPEYTSLLISHKSISRG
DNQSLTMIDLGYTPRYSITSYEGMKNYYANPKQMKIFPLPTNVPIVNILPIPRQSPYFAG
CHNPGLILLILGNGEIETMLYPSGIFTDKASLFPQNLSWLRPLATTSMAASVPNKLWLGA
LSAAQNKDYLLKGGVRTKRQKLPAEYGTAFITGHSNGSVRIYDASHGDIQDNASFEVNLS
RTLNKAKELAVDKISFAAETLELAVSIETGDVVLFKYEVNQFYSAENRPESGDLEMNFRR
FSLNNTNGVLVDVRDRAPTGVRQGFMPSTAVHANKGKTSAINNSNIGFVGIAYAAGSLML
IDRRGPAIIYMENIREISGAQSACVTCIEFVIMEYGDDGYSSILMVCGTDMGEVITYKIL
PASGGKFDVQLMDITNVTSKGPIHKIDAFSKETKSSCLATIPKMQNLSKGLCIPGIVLIT
GFDDIRLITLGKSKSTHKGFKYPLAATGLSYISTVEKNNDRKNLTVIITLEINGHLRVFT
IPDFKEQMSEHIPFPIAAKYITESSVLRNGDVAIRVSEFQASLFSTVKEQDTLAPVSDTL
YINGIRIPYRPQVNSLQWARGTVYCTPAQLNELLGGVNRPASKYKESIIAEGSFSERSSD
DNNANHPEHQYTKPIRKGRNSSYGVLRNVSRAVETRWDAVEDRFNDYATAMGETMNEAVE
QTGKDVMKGALGF
Download sequence
Identical sequences YPR032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]