SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR085C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR085C
Domain Number 1 Region: 19-360
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000529
Family WD40-repeat 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR085C
Sequence length 443
Comment ASA1 ORF Verified Putative protein of unknown function; subunit of the ASTRA complex (Rvb1p, Rvb2p, Tra1p, Tti1p, Tti2, Asa1p and Tra1p) which is part of the chromatin remodeling machinery
Sequence
MRGFSNEIILKRTLTLSDFTLRYHKRGITALQVIKAPSVSNVPVLLSGDNYGYFVMWDLV
TKRPITHIEIEGNSHIIAFWWVETTNVLYILSKDSMLRIFELDSSTQRSIDLVRKLSQAN
KTDHLQWTKIYEMPINTLNFANFIIEAEVKPTKDNKSYRLVCCHTDDSETIDIYQIIEDS
TFKLKRPFNNINFPRFLKQQNFLGISKDSKFGIIMRFAKLNDVIFLGYENGFVVGFKITF
DEGLQRDIAELVHVSNDHYPNPILDMCVSGDELYSCSTDDFITKYKIPVNLQLETKYLRD
DALLIKCPSSLRVSEPSKVHLPLKNIGHIDKVKDDYLVVSSWSGMTIVYNMRTSEVEQTF
VKSKNNLVVSDSTMGDLTNGSGSNTESSSKSHNYKVGAMTCLESFDVQSDGLRLGQLRRI
KALAKCNWCLIGYEDGTIKLNKI
Download sequence
Identical sequences YPR085C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]