SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR137W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR137W
Domain Number 1 Region: 188-361,397-442,473-531
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.43e-37
Family WD40-repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPR137W
Sequence length 573
Comment RRP9 ORF Verified Protein involved in pre-rRNA processing, associated with U3 snRNP; component of small ribosomal subunit (SSU) processosome; ortholog of the human U3-55k protein
Sequence
MSDVTQQKKRKRSKGEVNPSKPTVDEEITDPSSNEDEQLEVSDEEDALESEEEFEGENPA
DKRRRLAKQYLENLKSEANDILTDNRNAEEKDSNNLKERTIDEYNNFDAGDLDKDIIASR
LKEDVAEQQGRVFRYFGDKLLISEAKKSFTRVGENNLTCISCFQPVLNKYTFEESSNGDK
NKGRLFAYTVSKDLQLTKYDITDFSKRPKKLKYAKGGAKYIPTSKHEYENTTEGHYDEIL
TVAASPDGKYVVTGGRDRKLIVWSTESLSPVKVIPTKDRRGEVLSLAFRKYSDQLYASCA
DFKIRTYSINQFSQLEILYGHHDIVEDISALAMERCVTVGARDRTAMLWKIPDETRLTFR
GGDEPQKLLRRWMKENAKEGEDGEVKYPDESEAPLFFCEGSIDVVSMVDDSHFITGSDNG
NICLWSLAKKKPIFTERIAHGILPEPSFNDISGETDEELRKRQLQGKKLLQPFWITSLYA
IPYSNVFISGSWSGSLKVWKISDNLRSFELLGELSGAKGVVTKIQVVESGKHGKEKFRIL
ASIAKEHRLGRWIANVPGARNGIYSAVIDQTGF
Download sequence
Identical sequences YPR137W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]