SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR169W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR169W
Domain Number 1 Region: 27-58,121-397
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-21
Family WD40-repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPR169W
Sequence length 492
Comment JIP5 ORF Verified Essential protein required for biogenesis of the large ribosomal subunit; interacts with proteins involved in RNA processing, ribosome biogenesis, ubiquitination and demethylation; similar to WDR55, a human WD repeat protein
Sequence
MAKSKKKTDVVDSTNLPILELLSLKAPIFQSLLHPELPIIITGFGTGHIVCHRYDPAKLQ
SHLDRRRRIDTATTGKDAKKGVCPWIRLDIDLETGDLKLVDIEEQHQQKQTGKDEDLGVK
TLWKTKRHKGSVRAMCFDSKGDNIFSVGSDNVLKKANTMTGKVVKKVNLSSLFNSEEKKN
DKFTKLCASQTHPFILIGDESGNIHVINSENLALSNSIRSIHFGDSINDIFHFDKRSAYK
FISLGQTTLAYFDVRDKDAKPNVAGNEDGKILISDDQEDEVLCGCFVDPEVADTLLCGMG
EGIVTVWKPNKNDLEDQMSRIKISKDESIDCIVPTLQDDNCVWCGCSNGNIYKVNAKLGK
VVEVRNHSELDEVSFVDLDFEYRVVSGGLENIKIWELSSDDVEENASVESDSDEPLSHSD
EDLSDDTSSDDETTLVGLSKEELLDELDKDLKEDHQEEKESNSKSVKKRKIMKENNKKKD
LYEHGIKKFDDL
Download sequence
Identical sequences YPR169W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]