SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR178W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR178W
Domain Number 1 Region: 174-465
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.02e-68
Family WD40-repeat 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR178W
Sequence length 465
Comment PRP4 ORF Verified Splicing factor, component of the U4/U6-U5 snRNP complex
Sequence
MSKYIALENLPVDLQHKGATQNESTADILKQLPHERLQAVLEKIPEEDLEVRRLLSILKK
PEVVENEDVQQRRIRLAEILMVDEIDLENINNMEHINGEEVDEEDDEDFFTPATSELIFA
RRFLIKYSLERSRKRLQKEMERHQKFNTRQELLSRRTELQRMANLELAGSQLVSTKPISA
VSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDWHPDSNNQMISCAED
GLIKNFQYSNEEGDLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQEL
LLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPN
GYQVATGGGDGMINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCGYDNLIN
VYSSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN
Download sequence
Identical sequences YPR178W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]