SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YER007W from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YER007W
Domain Number 1 Region: 95-339
Classification Level Classification E-value
Superfamily RNI-like 9.42e-30
Family 28-residue LRR 0.021
Further Details:      
 
Domain Number 2 Region: 2-133
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.45e-24
Family Cap-Gly domain 0.002
Further Details:      
 
Domain Number 3 Region: 425-503
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000659
Family Ubiquitin-related 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YER007W
Sequence length 518
Comment PAC2 ORF Verified Microtubule effector required for tubulin heterodimer formation, binds alpha-tubulin, required for normal microtubule function, null mutant exhibits cold-sensitive microtubules and sensitivity to benomyl
Sequence
MTYEIGDRLKIGGYFCTIKFIGVIKPWPSVKAYGVEWDDHSRGKHSGTIDDIHYFDVQIP
NSGSFLKESKIKSPGVRRITFYEALSEKYGGSSNNINDLSIGNKRVEGLGFDELNARNKN
YKKLRKIALRDSDVAILFQNQDELNRVIQNCVNVKDLDLSLNLFTNINSLCEFIEPLKNL
ESLNISQNKLLSGWDNLKEYDLSHIKTLRLSSCGLSYKHIGKLLKSFRTLKMLDLSYNNL
TSAGIQNFENEIPCTLEELNISGNNLISFPLFPKNLTLKGLNVSNNQISRAPSIAIYSVE
SLDITDNKFKERSLIDDLNKTFPSLKNIHLSGNEFNYNGNDINVEEQATFYEVLARFDRV
MVLNGSICDVKTRREAEMFFVSKVMNNELSYDTNLPRWSSLIKSYEIDMSKLSFNNERET
RQSLVLKIKIRAGKKPSSDLDYWVLPSFTVRYVKSVICRKLNFDILNVKLFHENSEGMIN
EIKYNFRPISDFNVVNGDIIHVSSPVNNKSIQKVNSPS
Download sequence
Identical sequences A0A0L8VSN1 A6ZQV3 B5VHD8 C8Z706 E7QDS2 G2WCN7 H0GEZ5
YER007W tr|A6ZQV3|A6ZQV3_YEAS7 YER007W YER007W YER007W YER007W YER007W YER007W YER007W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]