SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL046C from Saccharomyces cerevisiae T7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL046C
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily POZ domain 3.9e-36
Family BTB/POZ domain 0.00000607
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL046C
Sequence length 99
Comment ELC1 ORF Verified Elongin C, involved in transcription elongation as a heterodimer with Ela1p; required for ubiquitin-dependent degradation of Rpo21p; plays a role in global genomic nucleotide excision repair; expression highly upregulated during sporulation
Sequence
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
Download sequence
Identical sequences A0A250WDI1 A6ZWK2 C7GU08 G2WPD2 N1NVZ0 Q03071
YPL046C YPL046C 1hv2_A YPL046C YPL046C YPL046C 4932.YPL046C YPL046C 1hv2A YPL046C YPL046C YPL046C YPL046C YPL046C tr|A6ZWK2|A6ZWK2_YEAS7 000006267|e1hv2A1|226.1.1.6|A:1-99 cath|current|1hv2A00/1-99 d1hv2a_ NP_015279.1.97178 YPL046C YPL046C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]