SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR073W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR073W
Domain Number 1 Region: 638-996
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-99
Family Oxysterol-binding protein 0.00069
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-18
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 7-45,125-189
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0000549
Family Supernatant protein factor (SPF), C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR073W
Sequence length 996
Comment OSH3 ORF Verified Member of an oxysterol-binding protein family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability
Sequence
METIDIQNRSFVVRWVKCGRGDVINYQIKPLKKSIEVGIYKKLKSSVDDHASAVHIAPDT
KTLLDYTTKSLLHKGSSSHIEEHHRRSSQHSHSSSNGSDNKRKERSYSSLSISGIQQQSQ
EIPLREKLSASGFTLVKRVGNVSGNTMVQGDLEVKDTDYYYAFILDNSSSKNAKKKILFN
ASVINGDNQSMISTRSTPPARPTALSRTSTQQDMLFRVGQGRYLQGYLLKKRRKRLQGFK
KRFFTLDFRYGTLSYYLNDHNQTCRGEIVISLSSVSANKKDKIIIIDSGMEVWVLKATTK
ENWQSWVDALQTCFDDQFEDKDTSTLEENPDILDDDKEVINKSSPQDHDHLTPTATTKSA
LSHRQHTQKDMDDIYVPLPSESYATFSMNLRLIQQRLEQCKKDSLSYKPTTLHQRSEGLN
GTHSSSSVFTNNRVSSFNHSSSGMTSSDSLASEEVPSNKTYIEHALYNQLADLEVFVSRF
VTQGEVLFKDHQILCKKAKDTRVSLTSYLSENDEFFDAEEEISRGVIILPDTEDDINNIV
EETPLLGKSDQNEFTTEVQLSGSEQIASSSVESYTTNDENHSRKHLKNRHKNRRRGHPHH
QKTKSAQSSTETFTSKDLFALSYPKSVTRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAM
PVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFN
PLLAETFELIREDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNN
EGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFEVHSSKGDKSHILFDKAGMF
SGRSEGFKVSIIPPPSSNRKKETLAGKWTQSLANETTHETIWEVGDLVSNPKKKYGFTKF
TANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNKGQDVEP
KYFEKVSKNEWKYIIGPKSYWERRKKHDWSDISQLW
Download sequence
Identical sequences G2WFE6
YHR073W YHR073W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]