SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR131C from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR131C
Domain Number - Region: 149-186,253-296
Classification Level Classification E-value
Superfamily PH domain-like 0.00387
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number - Region: 769-842
Classification Level Classification E-value
Superfamily ARM repeat 0.0299
Family GUN4-associated domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YHR131C
Sequence length 853
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; overexpression causes a cell cycle delay or arrest
Sequence
MALPIEGKLSMANNRIERLKSPSSSSTCSMDEVLITSSNNSSSICLETMRQLPREGVSGQ
INIIKETAASSSSHAALFIKQDLYEHIDPLPAYPPSYDLVNPNKEVRFPIFGDTAPCPKS
SLPPLYAPAVYELTLISLKLERLSPYEISSNRSWRNFIIEINSTQLNFYHIDESLTKHIR
NYSSGETKSEKEDRIHSDLVHRSDQSQHLHHRLFTLPTRSASEFKKADQERISYRVKRDR
SRYLTDEALYKSFTLQYARFGIPTDYTKKSFVLRMSCESEQFLLRFSHIDDMIDWSMYLS
IGISVSLDLEVREYPDYRIVPRRRRRRRRRRRRRRHTHRSESSMGSFSQRFIRSNSRPDL
IQRYSTGSSTNNNTTIRERSNTFTAGLLDHYCTGLSKTPTEALISSAASGESSDNSTLGS
TRSLSGCSASRSIASRSLKFKIKNFFRPKNSSRTEKLHRLRSNSSNLNSVIETEEDDEHH
ESNGGDHPEPGVSVNTTIKVERPMHRNRAISMPQRQSLRRAISEEVVPIKFPNSTVGESV
HSPSPIEHLSVDGCEIMLQSQNAVMKEELRSVASNLVANERDEASIRPKPQSSSIYLSGL
APNGESATDLSQSSRSLCLTNRDAEINDDESATETDEDENDGDTDEYAGDDTNDDTDDSN
IGYAYGSESDYSCLIEERIRNRRRASSTLSCFSNIPYGTDDIKWKPAIKEISRRRYLRDS
LKCIKPFLDSNDCLGKVIYIPVSGPTFETSNKIHFSNRQSLQKQKNHFLKGFIVGPTALI
ELNCKNKNAIVGTTKDAEDHGEDDGDGDDGEDDDDDDDDDDDDDDDEDDDDDDDDDDDDE
TMTMMTDRLLHKL
Download sequence
Identical sequences YHR131C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]