SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR155W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YHR155W
Domain Number 1 Region: 311-421
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000268
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 
Domain Number 2 Region: 13-271,306-335
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000272
Family BAR domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YHR155W
Sequence length 709
Comment YSP1 ORF Verified Mitochondrial protein with a potential role in promoting mitochondrial fragmentation during programmed cell death in response to high levels of alpha-factor mating pheromone or the drug amiodarone
Sequence
MHEHKAELRLITVALNEASTDSPSFRASVNYFHTRMESLSSWMHSTVDYVENTYKPSFQD
FQRIKETLFSQLLPSPILLSNGFVSNQPYTPLLVRDFTRDVSDLSNTVMKIILGDENSQY
TAALSALSSDAINPYFNKRKTFEYYQRKYDSFLTDFLAATNDGNTLIPQNLQNETFKLFD
IKHKYIEASLDLTEAISLMKVNLDKFLIETIDIVRKNNVITTKDTKDVIDITPELTETLK
DWTDWIESNLQTLQALSSKLSEAKYAILKLSLARMKPSRLIQDYDLKSIQNLKFDLPKSI
SDGNNSEEKGLSGWLYMKTTVGHDPKRVVWVRRWCFLQNNVFGVFSLSPSKTYVEETDKF
GILWITVEYLPKEPRNFCFKLRIQNPNCKTEEENTYIDIILQAESIDELKSWINTLTSHK
RIALSIKEENDPRYQLARKKIEPQFFEFASSSSTSTDKLLTSFSSKTLTLVEELKKNYMS
EDDIYSIIDNKAYHLRVISTPIATQLTHLALFSTFLSVSNYYPCATQANTWGTANWNDLS
YLVNPLKGSSVHKPATVSNSSRFSVSYPDYYPYSLKVDDIQFRSIFFSVNHDFLQVPKEL
VLLRYSSVWCPNNKQKFASMAFVTLNHIYVYLNISGFSYLRRIDLLDIDSIEYDKSPKHV
SSRMLHMQRGDGLRFNMSVFFTDRRAVASKLQFLIENKAMHIPKGEKEF
Download sequence
Identical sequences YHR155W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]