SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL113W from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL113W
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-19
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOL113W
Sequence length 342
Comment SKM1 ORF Verified Member of the PAK family of serine/threonine protein kinases with similarity to Ste20p and Cla4p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth
Sequence
MKGVKKEGWISYKVDGLFSFLWQKRYLVLNDSYLAFYKSDKCNEEPVLSVPLTSITNVSR
IQLKQNCFEILRATDQKENISPINSYFYESNSKRSIFISTRTERDLHGWLDAIFAKCPLL
SGVSSPTNFTHKVHVGFDPKVGNFVGVPDSWAKLLQTSEITYDDWNRNSKAVIKALQFYE
DYNGLDTMQFNDHLNTSLDLKPLKSPTRYIINKRTNSIKRSVSRTLRKGKTDSILPVYQS
ELKPFPRPSDDDYKFTNIEDNKVREEGRVHVSKESTADSQTKQLGKKEQKVIQSHLRRHD
NNATFKPHRLAPSAPATKIMIGKLNGIRRISLNLRIMMIRMK
Download sequence
Identical sequences YOL113W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]