SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL115C from Saccharomyces cerevisiae T73

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL115C
Domain Number 1 Region: 901-1107
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00086
Further Details:      
 
Domain Number 2 Region: 623-762
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000212
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 3 Region: 543-612
Classification Level Classification E-value
Superfamily PX domain 0.0000183
Family PX domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL115C
Sequence length 1128
Comment BEM3 ORF Verified Rho GTPase activating protein (RhoGAP) involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly
Sequence
MTDNLTTTHGGSTTLELLAQYNDHRSKKDKSIEHIEKGTCSGKERNPSYDEIFTENIKLK
LQVQEYETEIESLEKVIDMLQKNREASLEVVLEQVQNDSRDSYVNDQSFVLPPRSAERKA
HIKSLNLPIPTLSPPLQQGSDVALETSVTPTVPQIGVTSNTSISRKHLQNMILNDEIEAN
SSFSSPKTINRSVSSPTKIHSEQLASPAASVTYTTSRITIKSPNKGSKSPLQERLRSPQN
PNRMTAVINNHLHSPLKASTSNNLDELTESKSQQLTNDAIQKNDRVYSSITSSAYTTGTP
TSAAKSPSSLLEVKEGENKALGFSPASKEKLDDFTQLLDSSFGEEDLVNTDSKDPLSIKS
TINESLPPPPAPPTFFSPTSSGNIKNSTPLSSHLASPVILNKKDDNFGAQSAKNLKKPVL
TSSLPNPSTKLSTTSQNASLPPNPPVESSSKQKQLGETASIHSTNTLNTFSSTPQGSLKT
LRRPHASSVSTVKSVAQSLKSDIPLFVQPEDFGTIQIEVLSTLYRDNEDDLSILIAIIDR
KSGKEMFKFSKSIHKVRELDVYMKSHVPDLPLPTLPDRQLFQTLSPTKVDTRKNILNQYY
TSIFSVPEFPKNVGLKIAQFISTDTVMTPPMMDDNVKDGSLLLRRPKTLTGNSTWRVRYG
ILRDDVLQLFDKNQLTETIKLRQSSIELIPNLPEDRFGTRNGFLITEHKKSGLSTSTKYY
ICTETSKERELWLSAFSDYIDPSQSLSLSSSRNANDTDSASHLSAGTHHSKFGNATISAT
DTPSYVTDLTQEYNNNNNISNSSNNIGNSDGIDSNPSSHSNFLASSSGNAEEEKDSRRAK
MRSLFPFKKLTGPASAMNHIGITISNDSDSPTSPDSIIKSPSKKLMEVSSSSNSSTGPHV
STAIFGSSLETCLRLSSHKYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKT
LQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFL
SFKRVVDENHNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRN
LCIVFSPTLNIPISMLQPFITDFACIFQGGEPVKEEEREKVDIHIPQV
Download sequence
Identical sequences YPL115C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]