SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR112C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR112C
Domain Number 1 Region: 104-339
Classification Level Classification E-value
Superfamily TPR-like 1.04e-38
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 
Domain Number 2 Region: 37-137
Classification Level Classification E-value
Superfamily TPR-like 1.95e-18
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 
Domain Number 3 Region: 310-398
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000109
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR112C
Sequence length 963
Comment CYC8 ORF Verified General transcriptional co-repressor, acts together with Tup1p; also acts as part of a transcriptional co-activator complex that recruits the SWI/SNF and SAGA complexes to promoters; can form the prion [OCT+]
Sequence
MNPGGEQTIMEQPAQQQQQQQQQQQAAVPQQPLDPLTQSTAETWLSIASLAETLGDGDRA
AMAYDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWVTLGHCYL
MLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEK
TNEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKE
AYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLKSLEADPSDATTWYHLGRV
HMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISE
VWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGNINKSNGAP
TNASPGPPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQHHPAQQTPINSSATMYS
NGASPQLQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQ
AQAQAQAQAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLQPLPRQQLQQKGVSV
QMLNPQQGQPYITQPIVIQAHQLQPFSTQAMEHPQSSQLPPQQQQLQSVQHPQQLQGQPQ
AQAPQPLIQHNVEQNVLPQKRYMEGAIHTLVDAAVSSSTHTENNTKSPRQPTHAIPTQAP
ATGITNAEPQVKKQKLNSPNSNINKLVNTATSIEENAKSEVSNQSPAVVESNTNNTSQEE
KPVKANSIPSVIGAQEPPQEASPAEEATKAASVSPSTKPLNTEPESSSVQPTVSSESSTT
KANDQSTAETIELSTATVPAEASPVEDEVRQHSKEENGTTEASAPSTEEAEPAASRDAEK
QQDETAATTITVIKPTLETMETVKEEAKMREEEQTSQEKSPQENTLPRENVVRQVEEDEN
YDD
Download sequence
Identical sequences YBR112C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]