SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YCL028W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YCL028W
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily TPR-like 0.0342
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCL028W
Sequence length 405
Comment RNQ1 ORF Verified [PIN(+)] prion, an infectious protein conformation that is generally an ordered protein aggregate
Sequence
MDTDKLISEAESHFSQGNHAEAVAKLTSAAQSNPNDEQMSTIESLIQKIAGYVMDNRSGG
SDASQDRAAGGGSSFMNTLMADSKGSSQTQLGKLALLATVMTHSSNKGSSNRGFDVGTVM
SMLSGSGGGSQSMGASGLAALASQFFKSGNNSQGQGQGQGQGQGQGQGQGQGSFTALASL
ASSFMNSNNNNQQGQNQSSGGSSFGALASMASSFMHSNNNQNSNNSQQGYNQSYQNGNQN
SQGYNNQQYQGGNGGYQQQQGQSGGAFSSLASMAQSYLGGGQTQSNQQQYNQQGQNNQQQ
YQQQGQNYQHQQQGQQQQQGHSSSFSALASMASSYLGNNSNSNSSYGGQQQANEYGRPQH
NGQQQSNEYGRPQYGGNQNSNGQHESFNFSGNFSQQNNNGNQNRY
Download sequence
Identical sequences G2W9Z7 K4HWR2
YCL028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]