SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL107W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL107W
Domain Number 1 Region: 157-337
Classification Level Classification E-value
Superfamily TPR-like 0.0000011
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  YDL107W
Domain Number - Region: 74-155
Classification Level Classification E-value
Superfamily Prefoldin 0.0811
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL107W
Sequence length 351
Comment MSS2 ORF Verified Peripherally bound inner membrane protein of the mitochondrial matrix involved in membrane insertion of C-terminus of Cox2p, interacts genetically and physically with Cox18p
Sequence
MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENI
PWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSF
NVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQE
FLKLESSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYM
SSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFF
DCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRKDSIKLLDKARL
Download sequence
Identical sequences A0A250W9V1 G2WC55
YDL107W YDL107W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]