SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR161W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR161W
Domain Number 1 Region: 16-75,163-199,240-274
Classification Level Classification E-value
Superfamily TPR-like 0.0000000119
Family Tetratricopeptide repeat (TPR) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR161W
Sequence length 387
Comment ORF Uncharacterized Putative protein of unknown function; non-essential gene; proposed function in rRNA and ribosome biosynthesis based on transcriptional co-regulation; genetic interactions suggest a role in ER-associated protein degradation (ERAD)
Sequence
MSELEATIRQAKEALAENNAKKALKILKPFKSSLKKENASNVILNEVFADAYLDNGQVEK
AYPILARACELDPEGQVGGPDKFFTMGQIMGGQDGVSIITRGIMNISNTGGEMLTNVQVE
KIVGGLLSMIEIWMTDLCMEPNAEEQCEELIQKAMELTEGKSPETWSTLGSIKISQQKFG
EAYEAFSQAWNFFELKKQEIGSGINENGDTTQKAGLQSEYVDLLQPLLSLTKMCLEVGAY
EVALKVIAAVRDIDEDNIEGYYLEGFTYYLMSKLEIFKLNNPEVSLRPENIYEFNQLIQE
VPLDLSHEPISQLIYDSRLALSFALQAGINADSKDEIVQELLGGANALLQEIGGPLDPSE
LTQIKKGDLVNENEDLEELDIEEEYSD
Download sequence
Identical sequences A0A250W8Q2 A6ZYB9 G2WAQ9 N1P4U8
YDR161W YDR161W tr|A6ZYB9|A6ZYB9_YEAS7 YDR161W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]