SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR235W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR235W
Domain Number 1 Region: 20-495
Classification Level Classification E-value
Superfamily TPR-like 2.54e-18
Family HAT/Suf repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR235W
Sequence length 544
Comment PRP42 ORF Verified U1 snRNP protein involved in splicing, required for U1 snRNP biogenesis; contains multiple tetriatricopeptide repeats
Sequence
MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTY
SSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVV
SNQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFS
KFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKLKKITKEM
YMVVQYQVLEIYSIFESKIYINYYTSPETLVSSDEIETWIKYLDYTITLQTDSLTHLNFQ
RALLPLAHYDLVWIKYSKWLINSKNDLLGAKNVLLMGLKFSLKKTEIIKLLYSVICKLNE
YVLLRNLLEKIESSYSDNVENVDDFEIFWDYLQFKTFCQNSLYSSRYSDSQSNGLLNKEL
FDKVWKRLSCKEKKSGQEILLNNLVQFYSKDTVEFVEKNIFQKIIESGWEYYLQNGMFWN
CYCRLIYFDTSRSYLDKRQYIVKKIWPQIDKKFAQSVLPSLTEFCQSYFPEEMDTLEEMF
TEEP
Download sequence
Identical sequences A0A250W9D3 G2WAX9
YDR235W YDR235W YDR235W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]