SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR123C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR123C
Domain Number 1 Region: 197-508
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.75e-94
Family Protein serine/threonine phosphatase 0.000000195
Further Details:      
 
Domain Number 2 Region: 8-141
Classification Level Classification E-value
Superfamily TPR-like 1.16e-28
Family Tetratricopeptide repeat (TPR) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGR123C
Sequence length 513
Comment PPT1 ORF Verified Protein serine/threonine phosphatase with similarity to human phosphatase PP5; present in both the nucleus and cytoplasm; expressed during logarithmic growth; computational analyses suggest roles in phosphate metabolism and rRNA processing
Sequence
MSTPTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVD
NFQSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPAATKAL
LTCDRFIREERFRKAIGGAENEAKISLCQTLNLSSFDANADLANYEGPKLEFEQLYDDKN
AFKGAKIKNMSQEFISKMVNDLFLKGKYLPKKYVAAIISHADTLFRQEPSMVELENNSTP
EVKISVCGDTHGQFYDVLNLFRKFGKVGPKHTYLFNGDFVDRGSWSCEVALLFYCLKILH
PNNFFLNRGNHESDNMNKIYGFEDECKYKYSQRIFNMFSQSFESLPLATLINNDYLVMHG
GLPSDPSATLSDFKNIDRFAQPPRDGAFMELLWADPQEANGMGPSQRGLGHAFGPDITDR
FLRNNKLRKIFRSHELRMGGVQFEQKGKLMTVFSAPNYCDSQGNLGGVIHVVPGHGILQA
GRNDDQNLIIETFEAVEHPDIKPMAYSNGGFGL
Download sequence
Identical sequences YGR123C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]