SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL082W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YJL082W
Domain Number - Region: 404-503
Classification Level Classification E-value
Superfamily TPR-like 0.000456
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJL082W
Sequence length 731
Comment IML2 ORF Verified Protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MFRVFGSFGSKGNQSSGEEQSTKTKQVLKQANDFEIALKAMDFVLDDRTDEGLNLLKKAE
METGSDQTILTLARGVIEFLQATLSFETEEMKRAAITLGKAEQMSWKSKQNAEKTNFRSS
SIYPPGTVYAVTYTESCLLHALLMLFSESMMEAAKALLKLRRAYTMLQDIMVTVKKAERS
KNSSSPSPSEKSQESCGSFVSAETTFISVDIPYKLSSEDKSNPLLLEFAEKIYTMRMGRL
SGAHIGNTPSFHRLRDDLGLQTTPSQASDRHSVSDDFDLEQATIDEFIHSGANLCYGILQ
VVLSLLPPAIGAVLSIVGFKGSREEGLRLVWKATKERNVHGCIGLLGLMFYYDGPFQFTD
ADFDIPPNDNGSRALNKSRTNDNSLLPGYMDSATLLHPGKILEDALLKARALFPNSALWL
LNEAKMLAGKGRLRDSLALMDSIDVNSIRMRQVKSLMVFERAILLVNLHEYNRAADDLIS
LLDISDWSHALYTYFAGCCYLENWRMTQLGLLNDGKEQFYKERARELIFDAPSLLGKKTF
KSKNLPLDRFMLRKVQQFNNMQKKLNLQEPLDSIATSPVHELAYFYNGYNRMTENDLILT
KKMLTEYHNPAIDSEDPDQELIRNLLLSLTLRRLGDAERGLALLDDIVLPKIFYIQNGKV
KYFKKTEDPWAYPAALYERALFCWKLGGMESLNECREWLLRAQNYAADYELSTRIGMKIK
AALDRVENALA
Download sequence
Identical sequences A0A250WHL1 G2WGT5
YJL082W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]