SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR032W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR032W
Domain Number 1 Region: 4-202
Classification Level Classification E-value
Superfamily Cyclophilin-like 9.94e-56
Family Cyclophilin (peptidylprolyl isomerase) 0.0000196
Further Details:      
 
Domain Number 2 Region: 238-383
Classification Level Classification E-value
Superfamily TPR-like 2.8e-21
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YJR032W
Sequence length 393
Comment CPR7 ORF Verified Peptidyl-prolyl cis-trans isomerase (cyclophilin), catalyzes the cis-trans isomerization of peptide bonds N-terminal to proline residues; binds to Hsp82p and contributes to chaperone activity
Sequence
MIQDPLVYLDISIDKKPIGRIVCKLFREKAPKTTENFYKLCAGDVKSPLKDQQYLSYKGN
GFHRVVKNFMIQAGDIVFGTQKDSSSSSVGKGGCSIYADKEEVKTDDESFCYGNFEDENL
GEFVEPFTLGMANLGSPNTNNSQFFITTYAAPHLNGKHSIFGQVVHGKSVVRTIENCRVD
SDGVPESDVRISDCGVWEKTMGVPLYNASNDQIGGDVYEEYPDDDTHFGDDDFGKALEAA
NIIKESGTLLFKKKDYSNAFFKYRKSLNYINEYMPEPDVDKERNIQFINLKMKIYLNLSL
VLFNLERYDDAIMYATYLLEMDNVPNRDQAKAYYRRGNSYLKKKRLDEALQDYIFCKEKN
PDDEVIEQRIEYVNRLIEENKEKARKNISKFFS
Download sequence
Identical sequences YJR032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]