SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YJR066W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJR066W
Domain Number 1 Region: 559-1196,1231-1455
Classification Level Classification E-value
Superfamily ARM repeat 3.6e-125
Family HEAT repeat 0.046
Further Details:      
 
Domain Number 2 Region: 2029-2196,2231-2366
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1e-93
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0029
Further Details:      
 
Domain Number 3 Region: 1956-2048
Classification Level Classification E-value
Superfamily FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 4.71e-38
Family FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) 0.0000307
Further Details:      
 
Domain Number 4 Region: 68-515,555-614
Classification Level Classification E-value
Superfamily ARM repeat 3.11e-27
Family Armadillo repeat 0.031
Further Details:      
 
Weak hits

Sequence:  YJR066W
Domain Number - Region: 1866-1953
Classification Level Classification E-value
Superfamily ARM repeat 0.00012
Family Armadillo repeat 0.068
Further Details:      
 
Domain Number - Region: 1467-1515,1593-1629
Classification Level Classification E-value
Superfamily TPR-like 0.0019
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YJR066W
Sequence length 2470
Comment TOR1 ORF Verified PIK-related protein kinase and rapamycin target; subunit of TORC1, a complex that controls growth in response to nutrients by regulating translation, transcription, ribosome biogenesis, nutrient transport and autophagy; involved in meiosis
Sequence
MEPHEEQIWKSKLLKAANNDMDMDRNVPLAPNLNVNMNMKMNASRNGDEFGLTSSRFGGV
VIGSNGDVNFKPILEKIFRELTSDYKEERKLASISLFDLLVSLEHELSIEEFQAVSNDIN
NKILELVHTKKTNTRVGAVLSIDTLISFYAYTERLPNETSRLAGYLQGLIPSNDVEVMRL
AAKTLGKLAVPGGTYTSDFVEFEIKSCLEWLTASTEKNSFSSSKPDHAKHAALLIITALA
ENCPYLLYQYLNSILDNIWRALRDPHLVIRIDASITLAKCLSTLRNRDPQLTSQWVQRLA
TSCEYGFQVNTLECIHASLLVYKEILFLKDPFLNQVFDQMCLNCIAYENHKAKMIREKIY
QIVPLLASFNPQLFAGKYLHQIMDNYLEILTNAPAKKIPHLKDDKPQILISIGDIAYEVG
PDIAPYVKQILDYIEHDLQTKFKFRKKFENEIFYCIGRLAVPLGPVLGKLLNRNILDLMF
KCPLSDYMQETFQILTERIPSLGPKINDELLNLVCSTLSGTPFIQPGSPMEIPSFSRERA
REWRNKSILQKTGESNDDNNDIKIIIQAFRMLKNIKSRFSLVEFVRIVALSYIEHTDPRV
RKLAALTSCEIYVKDNICKQTSLHSLNTVSEVLSKLLAITIADPLQDIRLEVLKNLNPCF
DPQLAQPDNLRLLFTALHDESFNIQSVAMELVGRLSSVNPAYVIPSIRKILLELLTKLKF
STSSREKEETASLLCTLIRSSKDVAKPYIEPLLNVLLPKFQDTSSTVASTALRTIGELSV
VGGEDMKIYLKDLFPLIIKTFQDQSNSFKREAALKALGQLAASSGYVIDPLLDYPELLGI
LVNILKTENSQNIRRQTVTLIGILGAIDPYRQKEREVTSTTDISTEQNAPPIDIALLMQG
MSPSNDEYYTTVVIHCLLKILKDPSLSSYHTAVIQAIMHIFQTLGLKCVSFLDQIIPTIL
DVMRTCSQSLLEFYFQQLCSLIIIVRQHIRPHVDSIFQAIKDFSSVAKLQITLVSVIEAI
SKALEGEFKRLVPLTLTLFLVILENDKSSDKVLSRRVLRLLESFGPNLEGYSHLITPKIV
QMAEFTSGNLQRSAIITIGKLAKDVDLFEMSSRIVHPLLRVLSSTTSDELSKVIMNTLSL
LLIQMGTSFAIFIPVINEVLMKKHIQHTIYDDLTNRILNNDVLPTKILEANTTDYKPAEQ
MEAADAGVAKLPINQSVLKSAWNSSQQRTKEDWQEWSKRLSIQLLKESPSHALRACSNLA
SMYYPLAKELFNTAFACVWTELYSQYQEDLIGSLCIALSSPLNPPEIHQTLLNLVEFMEH
DDKALPIPTQSLGEYAERCHAYAKALHYKEIKFIKEPENSTIESLISINNQLNQTDAAIG
ILKHAQQHHSLQLKETWFEKLERWEDALHAYNEREKAGDTSVSVTLGKMRSLHALGEWEQ
LSQLAAIKWKVSKLQTKKLIAPLAAGAAWGLGEWDMLEQYISVMKPKSPDKEFFDAILYL
HKNDYDNASKHILNARDLLVTEISALINESYNRAYSVIVRTQIITEFEEIIKYKQLPPNS
EKKLHYQNLWTKRLLGCQKNVDLWQRVLRVRSLVIKPKQDLQIWIKFANLCRKSGRMRLA
NKALNMLLEGGNDPSLPNTVKAPPPVVYAQLKYIWATGAYKEALNHLIGFTSRLAHDLGL
DPNNMIAQSVKLSSASTAPYVEEYTKLLARCFLKQGEWRIATQPNWRNTNPDAILGSYLL
ATHFDKNWYKAWHNWALANFEVISMVQEETKLNGGKNDDDDDTAVNNDNVRIDGSILRSG
SLTINGNRYPLELIQRHVVPAIKGFFHSISLLETSCLQDTLRLLTLLFNFGGIKEVSQAM
YEGFNLMRIENWLEVLPQLISRIHQPDPTVSNSLLSLLSDLGKAHPQALVYPLTVAIKSE
SVSRQKAALSIIEKIRIHSPVLVNQAELVSHELIRVAVLWHELWYEGLEDASRQFFVEHN
IEKMFSTLEPLHKHLGNEPQTLSEVSFQKSFGRDLNDAYEWLNNYKKSKDINNLNQAWDI
YYNVFRKITRQIPQLQTLDLQHVSPQLLATHDLELAVPGTYFPGKPTIRIAKFEPLFSVI
SSKQRPRKFSIKGSDGKDYKYVLKGHEDIRQDSLVMQLFGLVNTLLKNDSECFKRHLDIQ
QYPAIPLSPKSGLLGWVPNSDTFHVLIREHRDAKKIPLNIEHWVMLQMAPDYENLTLLQK
IEVFTYALDNTKGQDLYKILWLKSRSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSN
LMLDRITGKVIHIDFGDCFEAAILREKYPEKVPFRLTRMLTYAMEVSGIEGSFRITCENV
MRVLRDNKESLMAILEAFALDPLIHWGFDLPPQKLTEQTGIPLPLINPSELLRKGAITVE
EAANMEAEQQNETRNARAMLVLRRITDKLTGNDIKRFNELDVPEQVDKLIQQATSIERLC
QHYIGWCPFW
Download sequence
Identical sequences YJR066W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]