SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKR027W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR027W
Domain Number 1 Region: 343-401
Classification Level Classification E-value
Superfamily TPR-like 0.00000601
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Weak hits

Sequence:  YKR027W
Domain Number - Region: 253-344
Classification Level Classification E-value
Superfamily ARM repeat 0.00792
Family BC3264-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YKR027W
Sequence length 765
Comment BCH2 ORF Verified Member of the ChAPs family of proteins (Chs5p-Arf1p-binding proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms the exomer complex with Chs5p to mediate export of specific cargo proteins, including Chs3p, from the Golgi to the plasma membrane
Sequence
MSFLWGSTKSKKGKNKKAAGSLPSGVVPQQRVKPTRKNVPIDYPRTLEKVHGESLIFRTS
LLSELVSTGKSGIGPPDLIHCTELDKFHDEKIGEYFYITGIDASSVSMPIAFLKLIKWND
GKKLKSASLKNDDITTYCTFNIFQKLDIRLRYESEDVYQVNIVDCLNGNNEIPLSDLIWE
ETFVSCCIRSVIINSDFERKIPGLVELPFVFENRCASDYKRVIDSLCKFLPRFLECGWDS
TKSVYATILNNYLTESLLVFLSITPEFITDYAIQVLDNLMTNDPSNSRYYAIVIISIMEQ
SNDRDVEMIKRIHEILDLLLPVLYGLPSDEPYISDLINCITDVLSIQARFLLNNNDYELS
LSISTLATNLSSDNFESWYLLSKGYIFSQQYDKALLSINSMPCLAEYDIVKQAQINAFKF
YMNYYKAPLCHSREHCTMTSHELNHLMNIMHYENELELKTIIFGRTVMPNESKYGCIEEI
WNKSCLELGPICGPQSDNLINFVSQQEVNTVGDMLLLKRSKETRQESWFIKQVRLLLMEL
VARIGWNALLQLRSDVFVMESKFKMIESSDKLSTELRQKRLCQRWFDAMFLNVYEDLSIS
TSSQENKATAKYSGLEWELLGLALLRVSDLPDAVACLRTSILARFDPISCHHLLNLYLTM
DFNDEFMRRFDVDIILDLLVKLISFRIRFYDRFQIFSLQVLRKLEGQLGSEIIKNKIINS
PYGQAGITSVIDYMLECLSKNRNEASLAYERPLPDLPSTIKPLAD
Download sequence
Identical sequences A0A250WJP4 G2WI58
YKR027W YKR027W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]