SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR067C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR067C
Domain Number - Region: 178-513
Classification Level Classification E-value
Superfamily TPR-like 0.0303
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR067C
Sequence length 965
Comment PET309 ORF Verified Specific translational activator for the COX1 mRNA, also influences stability of intron-containing COX1 primary transcripts; localizes to the mitochondrial inner membrane; contains seven pentatricopeptide repeats (PPRs)
Sequence
MKRCAPAVLRNYNYKKGIWSTGVPDHIRKLLRDKSTSPLCSQDERNLVSYFMARGSVPLK
SVGSGLTKKATTSITSNSATTTFERQYLIKYLYRHQAYGNVIKIAQKFLYTTIGSQRLLK
QDASLPELKKFLLSLLILQRGIQLDQAISDIIQRFLLTQKTMVIDLINSIFSRMVIMNMH
EEAVYKWVKWMKLVNGHCEFTNYMENKIVLRNFLSFMRQSNVRPDYLSYLKAIQLTQGPA
IASQFATTLLFLSTYIRKFSSAEAVWNYKCEHNLPIVSSDLTCILKTYCHMQKFNLVSST
YWKYPDAQHDQNQFDYLLVAHSRLHNWDALQQQFNALFGIGKLPSIQHYGILMYTMARIG
ELDSVNKLYTQLLRRGMIPTYAVLQSLLYAHYKVGDFAACFSHFELFKKYDITPSTATHT
IMLKVYRGLNDLDGAFRILKRLSEDPSVEITEGHFALLIQMCCKTTNHLIAQELFNLMTE
HYNIQHTGKSISALMDVYIESNRPTEAIALFEKHSKNLSWRDGLISVYNKAIKAYIGLRN
ANKCEELFDKITTSKLAVNSEFYKMMIKFLVTLNEDCETALSIIDQLIKHSVIKVDATHF
EIIMEAYDKEGYRDGIINLYKTMSQNKVPANSKILYYILKAVAKKSLQNNEEIKETINMV
EDIMENAANGTLDVTYNKLHPSVMAWPMRMIVKHDSPQRALELYNRYNELFFKKHDWISN
NNKFVMMRSLLVLLAQIEQWKDFETLFAKYMDRIENIENLPSSTTPNIKLRSIFSGLFPY
KVSQLIAMNKIDELPLLWKKLREKGFILDNISWNSAVEALFKDPRTLSYGMKIVDDTLIH
GYNLIHKFRLLTKLSEDKTQSSDKSWPTLKMKEKEPNKFQPRLYLKSDTYNSIMRQLDTY
LDGIDDLKTLEDQVRDFISNYKYFMKDYLLMPRSKINKWEQIEMRHLSYFKELRKSKRVL
PVSKF
Download sequence
Identical sequences YLR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]