SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR229C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR229C
Domain Number 1 Region: 1503-1724
Classification Level Classification E-value
Superfamily TPR-like 7.11e-38
Family HAT/Suf repeat 0.037
Further Details:      
 
Domain Number 2 Region: 1242-1345
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.42e-21
Family Cold shock DNA-binding domain-like 0.002
Further Details:      
 
Domain Number 3 Region: 1166-1252
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.46e-17
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 
Domain Number 4 Region: 785-879
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000112
Family Cold shock DNA-binding domain-like 0.0099
Further Details:      
 
Domain Number 5 Region: 605-682
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000216
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 
Domain Number 6 Region: 888-986
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000012
Family Cold shock DNA-binding domain-like 0.032
Further Details:      
 
Domain Number 7 Region: 501-586
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000231
Family Cold shock DNA-binding domain-like 0.018
Further Details:      
 
Domain Number 8 Region: 1082-1162
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000039
Family Cold shock DNA-binding domain-like 0.027
Further Details:      
 
Domain Number 9 Region: 979-1070
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000119
Family Cold shock DNA-binding domain-like 0.017
Further Details:      
 
Domain Number 10 Region: 697-779
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000249
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 
Domain Number 11 Region: 111-152,198-246
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000389
Family Cold shock DNA-binding domain-like 0.043
Further Details:      
 
Domain Number 12 Region: 322-409
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000821
Family Cold shock DNA-binding domain-like 0.058
Further Details:      
 
Weak hits

Sequence:  YMR229C
Domain Number - Region: 237-305
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000293
Family Cold shock DNA-binding domain-like 0.016
Further Details:      
 
Domain Number - Region: 1459-1503
Classification Level Classification E-value
Superfamily TPR-like 0.0031
Family HAT/Suf repeat 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YMR229C
Sequence length 1729
Comment RRP5 ORF Verified RNA binding protein with preference for single stranded tracts of U's involved in synthesis of both 18S and 5.8S rRNAs; component of both the ribosomal small subunit (SSU) processosome and the 90S preribosome
Sequence
MVASTKRKRDEDFPLSREDSTKQPSTSSLVRNTEEVSFPRGGASALTPLELKQVANEAAS
DVLFGNESVKASEPASRPLKKKKTTKKSTSRDSEASSANSDEARAGLIEHVNFKTLKNGS
SLLGQISAITKQDLCITFTDGISGYVNLTHISEEFTSILEDLDEDMDSDTDAADEKKSKV
EDAEYESSDDEDEKLDKSNELPNLRRYFHIGQWLRCSVIKNTSLEPSTKKSKKKRIELTI
EPSSVNTYADEDLVKSTSIQCAVKSIEDHGATLDVGLPGFTGFIAKKDFGNFEKLLPGAV
FLGNITKKSDRSIVVNTDFSDKKNKITQISSIDAIIPGQIVDLLCESITKNGIAGKVFGL
VSGVVNVSHLRTFSEEDLKHKFAIGSSIRCRIIACLENKSGDKVLILSNLPHILKLEDAL
KSTEGLDAFPIGYTFESCSIKGRDSEYLYLALDDDRLGKVHSSRVGEIENSENLSSRVLG
YSPVDDIYQLSTDPKYLKLKYLRTNDIPIGELLPSCEITSVSSSGIELKIFNGQFKASVP
PLHISDTRLVYPERKFKIGSKVKGRVISVNSRGNVHVTLKKSLVNIEDNELPLVSTYENA
KNIKEKNEKTLATVQVFKPNGCIISFFGGLSGFLPNSEISEVFVKRPEEHLRLGQTVIVK
LLDVDADRRRIIATCKVSNEQAAQQKDTIENIVPGRTIITVDVIEKTKDSVIVEIPDVGL
RGVIYVGHLSDSRIEQNRAQLKKLRIGTELTGLVIDKDTRTRVFNMSLKSSLIKDAKKET
LPLTYDDVKDLNKDVPMHAYIKSISDKGLFVAFNGKFIGLVLPSYAVDSRDIDISKAFYI
NQSVTVYLLRTDDKNQKFLLSLKAPKVKEEKKKVESNIEDPVDSSIKSWDDLSIGSIVKA
KIKSVKKNQLNVILAANLHGRVDIAEVFDTYEEITDKKQPLSNYKKDDVIKVKIIGNHDV
NSHKFLPITHKISKASVLELSMKPSELKSKEVHTKSLEEINIGQELTGFVNNSSGNHLWL
TISPVLKARISLLDLADNDSNFSENIESVFPLGSALQVKVASIDREHGFVNAIGKSHVDI
NMSTIKVGDELPGRVLKIAEKYVLLDLGNKVTGISFITDALNDFSLTLKEAFEDKINNVI
PTTVLSVDEQNKKIELSLRSATAKTRSIKSHEDLKQGEIVDGIVKNVNDKGIFVYLSRKV
EAFVPVSKLSDSYLKEWKKFYKPMQYVLGKVVTCDEDSRISLTLRESEINGDLKVLKTYS
DIKAGDVFEGTIRNVTDFGVFVKLDNTVNVTGLAHITEIADKKPEDLSALFGVGDRVKAI
VLKTNPEKKQISLSLKASHFSKEAELASTTTTTTTTDQVEKEDEDEVMADAGFNDSDSES
DIGDQNTEVADRKPETSSDGLSLSAGFDWTASILDQAQEEEESDQDQEDFTENKKHKHKR
RKENVVQDKTIDINTRAPESVADFERLLIGNPNSSVVWMNYMAFQLQLSEIEKARELAER
ALKTINFREEAEKLNIWIAMLNLENTFGTEETLEEVFSRACQYMDSYTIHTKLLGIYEIS
EKFDKAAELFKATAKKFGGEKVSIWVSWGDFLISHNEEQEARTILGNALKALPKRNHIEV
VRKFAQLEFAKGDPERGRSLFEGLVADAPKRIDLWNVYVDQEVKAKDKKKVEDLFERIIT
KKITRKQAKFFFNKWLQFEESEGDEKTIEYVKAKATEYVASHESQKADE
Download sequence
Identical sequences YMR229C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]