SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR237W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR237W
Domain Number - Region: 363-408,494-530,557-602
Classification Level Classification E-value
Superfamily TPR-like 0.000126
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YMR237W
Sequence length 724
Comment BCH1 ORF Verified Member of the ChAPs family (Chs5p-Arf1p-binding proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms the exomer complex with Chs5p to mediate export of specific cargo proteins from the Golgi to the plasma membrane; may interact with ribosomes
Sequence
MLSQTSIPEVKEDVIGYALHQRRARVGQFQDLGPPDLITLIKSLPSSSSTTTATASANDN
GATSNINGQDPTTIVTELHSHDKLKGQIGTFFYCMGIDTSDPTSITIFAKKITDLFLDTP
QIWFGKKKHFHVSKISISSWNAFRKYDVNIIVHIPGTVQTYIINSDGEQSQLPSVAEASS
GRNSQDLNVNMIWAETFMSGIVRDIMIMKDNRADGESQNLVETLIFNPLTSGELEDVANN
FIKLFPLVYEKGVYLDAPTHVLNPSLTNNYLVETLVEIVRLTKSLEACRKMLKKLIEIHP
EAVIILIRVYFACDLEIDAVDLINEQLNSPSSFLADDSKTSHIQLIFKSELLSIQSEFLL
DVKRDYKLAKEVAMEAVNCAPNEFKTWYLLTRIYIKLNDMPNALLSLNACPMSQVKEKYV
LRRIAPITSDENLHLPLPLDASIEEISSLNPMDVQLEQKSADPNLVNLSASSLKSTFQLA
YKLLTEIVQITGWEQLLKYRSKIFVMEDEYQGSTSSIDEAEVRGNDISKMRSKRLCERWL
DNLFMLLYEDLKTYTDWQSEQLYFDAQNSKYHKLTVEWELFGLCAKRLGHLPEAAKAFQI
GLSQRFSPVCAKNLLQFYIDEHKRIRRDSVSANSELTSSQILSSINDIDSSIIDLVVKIC
CWNHRWYIEFSIILIDALSVAVQDMGITKVHNEIASRFSDPVAQLIDDNILNFLKNFTND
TFDN
Download sequence
Identical sequences A0A250WEI2 A6ZMV0 G2WKU5
YMR237W YMR237W YMR237W YMR237W tr|A6ZMV0|A6ZMV0_YEAS7 YMR237W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]