SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL313C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL313C
Domain Number 1 Region: 634-739,792-827
Classification Level Classification E-value
Superfamily TPR-like 1.39e-17
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  YNL313C
Domain Number - Region: 516-603
Classification Level Classification E-value
Superfamily TPR-like 0.00621
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL313C
Sequence length 904
Comment EMW1 ORF Uncharacterized Essential protein of unknown function; fluorescent protein (GFP or YFP)-tagged protein localizes to cytoplasm and nucleus
Sequence
METLLHAKLLLSAEVESLKSGSFDQTYVKKAEHIISGESYQLVQQFVDKFKGKISISGEI
STSSVIAALNDFLNVEVFKMGQENEMLFLAIALLQTFIQNNYTGPAARLKAISGLFGKTG
IEIGAVNTALSRSLAIMGQPAYEFMDDPLYLVLSLLLLERITGQKSLFDVTPDQEIPLPI
ISAESTPGLLAVAYWWWARALLTQLSLIPEPSGFQASVASAIYQSADLAYAITKELPESI
HEDFKRELCAMYYLENVKCSLAINTEHLCLPSLTRAKKITNFEFVMTGARATRTKYQQKA
HAGLIILAKSFTFQNFALRTTSATPETFALESDLLLEKPHFESIADEPLDEQIYSKRQKV
DLNAGYEEDKLLPLALRQENIPKSLLDLNPNDQPTLSDYDNIQLLLRLYTIKNTTPAKDP
LVEEELTALLSRILYQNGEKNWSIFARSLWERSIIETTKAKTIERGLLQMQSLVEELDLK
IKSKLVPSSNEINVASRLSYIHQLPFIPRWQLDATLAEKYMSLGILKSAVEIYERLGMAC
ETALCYAAVGDEKKAEEILLQRINENDSDARAYSILGDIKQDPSLWEKSWEIGKYVNAKN
SLAKYYFNPPPKSGAQPNYSATLKHLNDSLRQYPLSFETWYFYGCVGLQCGKMQIAAEAF
TRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLVAVKLN
EWEDVLTACKQLVSIRRDKSGEGSIDLPIIEKLVELLVTSEYPEEPQQLSYFQKSCTEFI
CNTLPQVITTSARCWRLVARVELWRKRPWAALECHEKAYRAISHNPDLEVEEKVWNDTVD
ACEDLVAAYESLGEMEGKYGPGSLVCKDWKYKCRSTIKALMSKGKGRWDDSPGWDRLVEA
RSQI
Download sequence
Identical sequences A0A250WGN7 G2WLF6
YNL313C YNL313C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]