SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL064C from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL064C
Domain Number 1 Region: 49-259
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.79e-67
Family Glutathione peroxidase-like 0.00000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBL064C
Sequence length 261
Comment PRX1 ORF Verified Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin peroxidase activity, has a role in reduction of hydroperoxides; reactivation requires Trr2p and glutathione; induced during respiratory growth and oxidative stress; phosphorylated
Sequence
MFSRICSAQLKRTAWTLPKQAHLQSQTIKTFATAPILCKQFKQSDQPRLRINSDAPNFDA
DTTVGKINFYDYLGDSWGVLFSHPADFTPVCTTEVSAFAKLKPEFDKRNVKLIGLSVEDV
ESHEKWIQDIKEIAKVKNVGFPIIGDTFRNVAFLYDMVDAEGFKNINDGSLKTVRSVFVI
DPKKKIRLIFTYPSTVGRNTSEVLRVIDALQLTDKEGVVTPINWQPADDVIIPPSVSNDE
AKAKFGQFNEIKPYLRFTKSK
Download sequence
Identical sequences A0A0L8VW25 A0A250WF70 A6ZKN5 B3LNJ9 B5VDS3 C7GNA2 E7LRA8 E7NEM4 G2W8U5 H0GC37 N1PAW7 P34227
YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C tr|A6ZKN5|A6ZKN5_YEAS7 YBL064C YBL064C SCRT_03027 YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C YBL064C NP_009489.1.97178 YBL064C 4932.YBL064C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]