SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YEL003W from Saccharomyces cerevisiae UC5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL003W
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily Prefoldin 3.92e-19
Family Prefoldin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YEL003W
Sequence length 111
Comment GIM4 ORF Verified Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it
Sequence
MEQRNNVFQAKYNEYKQILEELQTKIIELGHDKDEHTIVIKTLKDAEPTRKCYRMIGGAL
VESDVQTSLPILETKKENIEGTISKMKETLIQTAKEFEKWKKDNKIQVVKN
Download sequence
Identical sequences C8Z6Z6 N1P3V9 P40005
YEL003W YEL003W NP_010913.2.97178 YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W 4932.YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W YEL003W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]